PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G197000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 321aa    MW: 33657.8 Da    PI: 6.3002
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G197000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.34.2e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEde+l++++++ G g+W+t +r  g++R++k+c++rw +yl
  Sevir.6G197000.1.p 14 KGPWTPEEDEKLLQYIQKNGHGSWRTLPRLAGLNRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding54.62.5e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Sevir.6G197000.1.p  67 RGKFSQEEEQTILHLHSVLGNK-WSAIAAHLP-GRTDNEIKNFWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.7961IPR017930Myb domain
SuperFamilySSF466895.24E-3211108IPR009057Homeodomain-like
SMARTSM007173.4E-151363IPR001005SANT/Myb domain
PfamPF002494.6E-171461IPR001005SANT/Myb domain
CDDcd001674.50E-121661No hitNo description
PROSITE profilePS5129426.57762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2865117IPR009057Homeodomain-like
SMARTSM007171.6E-1666114IPR001005SANT/Myb domain
PfamPF002492.7E-1667112IPR001005SANT/Myb domain
CDDcd001671.62E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLLQYIQ KNGHGSWRTL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILH LHSVLGNKWS AIAAHLPGRT DNEIKNFWNT HLKKRLIQMG  120
FDPMTHRPRT DFFAALPQLI ALAALRDQLG AAADPAAAQL QAGAAAGVDV AIQAAKLQYL  180
QCLFQSAATT IASTAAAGAA PDAEAAAAAL GGLCSPQGTH DSTAPPVSAA GGQLPSCTFP  240
EAPVSSEGNQ GLSYGGADVD VFAFHGGGSL PPLADLSDAA KYPSADGCSA TASSSFGGGA  300
TSPLPWPEFF PDDPFITDFL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-31121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-31121162105C-Myb DNA-Binding Domain
1msf_C7e-31121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283091e-168KJ728309.1 Zea mays clone pUT6589 MYB transcription factor (MYB63) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973754.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLK3YIN40.0K3YIN4_SETIT; Uncharacterized protein
STRINGSi014103m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-85myb domain protein 93